Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GS927692.1 | complete | 99 | 134-433(+) |
Amino Acid sequence : | |||
MSPSTTDEKKQMNVLHMQMPLVPLMYAMVCTRLDISHAVSMVSRYMHNPGKGHCQAVKWILRYIYGTVDIGLKFKSDKTEGKYLVGYVDFDYVGDLDKR* | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 11,393.248 | ||
Theoretical pI: | 8.887 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16055 | ||
Instability index: | 44.129 | ||
aromaticity | 0.101 | ||
GRAVY | -0.245 | ||
Secondary Structure Fraction | |||
Helix | 0.323 | ||
turn | 0.192 | ||
sheet | 0.212 |