Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GS927699.1 | internal | 183 | 2-550(+) |
Amino Acid sequence : | |||
FEFAKMQQQRRQIMGKTRTTLKYGIPSCFYEDQSNGSISSIVDPLHDYILSKQPKKFLSPTNFIYYKQENIEADSLSSFMMKSDQQEQFVQLPQLESPSLPLIKRSSPSLISLYDDQEDQ DQQNVNNKINNKKVTDWRALDKFVASQLSQEDNIGESSFSGGGGGHRDSNETASLLLHLCEFK | |||
Physicochemical properties | |||
Number of amino acids: | 183 | ||
Molecular weight: | 20,899.078 | ||
Theoretical pI: | 5.410 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
Instability index: | 71.753 | ||
aromaticity | 0.093 | ||
GRAVY | -0.749 | ||
Secondary Structure Fraction | |||
Helix | 0.273 | ||
turn | 0.279 | ||
sheet | 0.202 |