Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GT915152.1 | 5prime_partial | 127 | 1-384(+) |
Amino Acid sequence : | |||
LRPGYLLSRVVLVVMILLVVVNLSYCVISSDTSLMSVASQSNTSTSTNRNKMDKESLIGYDEEELEYQMDSEINRRILAGTNTYVTFMSNNFGPTSCGNKRSIGKSCVGPVNNQKTNCGK DVYYRAC* | |||
Physicochemical properties | |||
Number of amino acids: | 127 | ||
Molecular weight: | 14,068.887 | ||
Theoretical pI: | 8.320 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 10430 10680 | ||
Instability index: | 56.635 | ||
aromaticity | 0.071 | ||
GRAVY | -0.202 | ||
Secondary Structure Fraction | |||
Helix | 0.307 | ||
turn | 0.307 | ||
sheet | 0.197 |