Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GT915160.1 | 5prime_partial | 170 | 2-514(+) |
Amino Acid sequence : | |||
EKFLWFELILYMVAQCFGAICGCGLVKAFQKSHYNRYGGGANELSDGYSKGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPILAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV MYNDEKTWDHHWIFWVGPFIGAAIAAFYHQYILRAGAAKALGSFRSSAAI* | |||
Physicochemical properties | |||
Number of amino acids: | 170 | ||
Molecular weight: | 18,429.089 | ||
Theoretical pI: | 8.807 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33920 34045 | ||
Instability index: | 33.659 | ||
aromaticity | 0.147 | ||
GRAVY | 0.379 | ||
Secondary Structure Fraction | |||
Helix | 0.359 | ||
turn | 0.229 | ||
sheet | 0.259 |