Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GT915206.1 | 5prime_partial | 170 | 2-514(+) |
Amino Acid sequence : | |||
HYGRGHTKFSHSKPQHQRDMASLTNVMLSLSLCFVLVAISNINAQITLASAAKYSPTITQPPIFMVMPPTTPPPSSSMASPTPTSTSRQSTSPISSSPTEAQSPSSSTISPPISAGSESS PSSQPMSPGPSTTAGSPDGQLPVNAAAFLIQSNKINSVLVLMLAGVALGY* | |||
Physicochemical properties | |||
Number of amino acids: | 170 | ||
Molecular weight: | 17,479.622 | ||
Theoretical pI: | 9.363 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
Instability index: | 80.764 | ||
aromaticity | 0.041 | ||
GRAVY | -0.065 | ||
Secondary Structure Fraction | |||
Helix | 0.218 | ||
turn | 0.418 | ||
sheet | 0.212 |