Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GT915222.1 | 5prime_partial | 159 | 1-480(+) |
Amino Acid sequence : | |||
LALGGQITIITGIFYWIAQLIGSIVACSLLKFVTGGLAIPTHSVAAGVGSIEGVVMEIIITFALVYTVYATAADPKKGSLGTIAPIAIGFIVGANILAAGPFSGGSMNPARSFGPAVVSG DFHDNWIYWVGPLVGGGLAGLIYGNVFIHSDHQPLSSDF* | |||
Physicochemical properties | |||
Number of amino acids: | 159 | ||
Molecular weight: | 16,247.682 | ||
Theoretical pI: | 5.634 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 23950 | ||
Instability index: | 25.293 | ||
aromaticity | 0.107 | ||
GRAVY | 0.864 | ||
Secondary Structure Fraction | |||
Helix | 0.403 | ||
turn | 0.302 | ||
sheet | 0.220 |