Acc_NO	ORF type	length	start-end position (strand +/-)
>GT915267.1	5prime_partial	135	2-409(+)
Amino Acid sequence :
LIMASSKFCGIILVIAILFHSTFSSACGTCQTKPKPKPPSSSPSPSPSPVAHCPKDALKLGACVNLLGLVNVPIGTPISSKCCALLDGLADLEAALCLCTAIKANVLGLNLNVPVTLSLL ISACQKSVPPGFQCE*
Physicochemical properties
Number of amino acids:		135
Molecular weight:		13,772.344
Theoretical pI:		8.532
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		0 625
Instability index:		55.287
aromaticity		0.030
GRAVY		0.657
Secondary Structure Fraction
Helix		0.311
turn		0.319
sheet		0.267