Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GT915275.1 | complete | 104 | 63-377(+) |
Amino Acid sequence : | |||
MGVASRLMLVVVLMIAITSNEVVKVANAQSIRNASVSDLMACKSSVTAPNPTPPSASCCSVLSHADLSCLCSYKNSNVLPSLGIDPKLAMQLPAKCKLPHPANC* | |||
Physicochemical properties | |||
Number of amino acids: | 104 | ||
Molecular weight: | 10,795.713 | ||
Theoretical pI: | 8.778 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1865 | ||
Instability index: | 42.488 | ||
aromaticity | 0.010 | ||
GRAVY | 0.418 | ||
Secondary Structure Fraction | |||
Helix | 0.269 | ||
turn | 0.317 | ||
sheet | 0.288 |