Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GT915321.1 | 5prime_partial | 146 | 2-442(+) |
Amino Acid sequence : | |||
TNERERERREEMEANPMLLRRDVSSSSRVVLVVMILLVVVNLSYCVISSDTSLMSVESQSNTSTSTNRNKMDKESLIGYDEEELEYQMDSEINRRILAGTNTYVTFMSNNFGPTSCGNKR SIGKSCVGPVNNQKTNCGKDVYYRAC* | |||
Physicochemical properties | |||
Number of amino acids: | 146 | ||
Molecular weight: | 16,487.383 | ||
Theoretical pI: | 5.589 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 9190 | ||
Instability index: | 63.442 | ||
aromaticity | 0.055 | ||
GRAVY | -0.551 | ||
Secondary Structure Fraction | |||
Helix | 0.260 | ||
turn | 0.295 | ||
sheet | 0.226 |