Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GT915331.1 | complete | 107 | 33-356(+) |
Amino Acid sequence : | |||
MSPKYLLFLLIAVVVLTTYSSLVDADVDGYKYKRPHYPPKHYPPKKHYPPTEEEESSTTGIVDEEKASTTAEEDAKDYYKKRPPYHKPPHYKPTHYKPPQYKPPTAN* | |||
Physicochemical properties | |||
Number of amino acids: | 107 | ||
Molecular weight: | 12,436.898 | ||
Theoretical pI: | 8.602 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19370 19370 | ||
Instability index: | 83.254 | ||
aromaticity | 0.131 | ||
GRAVY | -1.143 | ||
Secondary Structure Fraction | |||
Helix | 0.262 | ||
turn | 0.243 | ||
sheet | 0.196 |