Acc_NO	ORF type	length	start-end position (strand +/-)
>GT915331.1	complete	107	33-356(+)
Amino Acid sequence :
MSPKYLLFLLIAVVVLTTYSSLVDADVDGYKYKRPHYPPKHYPPKKHYPPTEEEESSTTGIVDEEKASTTAEEDAKDYYKKRPPYHKPPHYKPTHYKPPQYKPPTAN*
Physicochemical properties
Number of amino acids:		107
Molecular weight:		12,436.898
Theoretical pI:		8.602
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		19370 19370
Instability index:		83.254
aromaticity		0.131
GRAVY		-1.143
Secondary Structure Fraction
Helix		0.262
turn		0.243
sheet		0.196