Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GT915371.1 | 5prime_partial | 180 | 1-543(+) |
Amino Acid sequence : | |||
PLRPGVVTRVSIGNERMTVKKMKSNRRASSVVCYAVPRNLQWVSTIASAVLMISKGTAIQKSFLVPLLAMQAPPSLIFWMKGEYGVWAAFLAFLVRLFFFIPGELELPFQALLLVLIAPY QVMNLRGTQEGAIVSLVIAGYLAFQHFSRTGSLQKAFDQGSIVATLAIICASAVSLLLLI* | |||
Physicochemical properties | |||
Number of amino acids: | 180 | ||
Molecular weight: | 19,673.351 | ||
Theoretical pI: | 10.238 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22585 | ||
Instability index: | 26.534 | ||
aromaticity | 0.100 | ||
GRAVY | 0.729 | ||
Secondary Structure Fraction | |||
Helix | 0.411 | ||
turn | 0.217 | ||
sheet | 0.311 |