Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GT915379.1 | 5prime_partial | 106 | 1-321(+) |
Amino Acid sequence : | |||
HEKTAMVPSGSVAAVVYRGRNADGHECDFLLSWDNPWQKIGQDNTVLAEISEVRHYENKSVWGPLYDKLEGGRSKSSANNKGCEISVAIGTGTSPTFKAILTLSGA* | |||
Physicochemical properties | |||
Number of amino acids: | 106 | ||
Molecular weight: | 11,899.214 | ||
Theoretical pI: | 9.637 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
Instability index: | 31.824 | ||
aromaticity | 0.088 | ||
GRAVY | 0.201 | ||
Secondary Structure Fraction | |||
Helix | 0.382 | ||
turn | 0.167 | ||
sheet | 0.255 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GT915379.1 | complete | 102 | 2-310(+) |
Amino Acid sequence : | |||
MKRLPWCPVALSLLLCIVVGMLMDMSVTFFCHGITHGKRLDRITQCLLRYLKFVTMRTNQSGVHFMINSKGVDLKAVPITRDVKYLWPLELELHQHLRQYSP* | |||
Physicochemical properties | |||
Number of amino acids: | 102 | ||
Molecular weight: | 11,899.214 | ||
Theoretical pI: | 9.637 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
Instability index: | 31.824 | ||
aromaticity | 0.088 | ||
GRAVY | 0.201 | ||
Secondary Structure Fraction | |||
Helix | 0.382 | ||
turn | 0.167 | ||
sheet | 0.255 |