Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GT915407.1 | 5prime_partial | 145 | 2-439(+) |
Amino Acid sequence : | |||
NSTTMQQAIPYKSWQSHLSLPSLNHNHPTVGKGKGKMKMINDMVTENPVTVIVRKGCCMGHVVKHLLMGHGVNPNVYEVDEKDEDGLIKELELINGGDEKTLISNLQFSAVFIGGRLYGG LDRVMAAHITGDKVPLLKQAGALWL* | |||
Physicochemical properties | |||
Number of amino acids: | 145 | ||
Molecular weight: | 12,733.699 | ||
Theoretical pI: | 9.778 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 19940 | ||
Instability index: | 56.922 | ||
aromaticity | 0.162 | ||
GRAVY | -0.032 | ||
Secondary Structure Fraction | |||
Helix | 0.400 | ||
turn | 0.171 | ||
sheet | 0.133 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GT915407.1 | complete | 105 | 385-68(-) |
Amino Acid sequence : | |||
MSSHNSVQPTIQSTPNKHSRKLQITYQGFLITTIDQFKLFDKTIFILFINLIYVRINSMTHKQMLHYMPHTTSFSHYYRNWVLCYHVIDHLHFAFSFTHRWMVVI* | |||
Physicochemical properties | |||
Number of amino acids: | 105 | ||
Molecular weight: | 12,733.699 | ||
Theoretical pI: | 9.778 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 19940 | ||
Instability index: | 56.922 | ||
aromaticity | 0.162 | ||
GRAVY | -0.032 | ||
Secondary Structure Fraction | |||
Helix | 0.400 | ||
turn | 0.171 | ||
sheet | 0.133 |