Acc_NO	ORF type	length	start-end position (strand +/-)
>GT915408.1	internal	177	531-1(-)
Amino Acid sequence :
IPYKSWQSHLSLPSLNHNHPTVGKGKGKMKMINDMVTENPVTVIVRKGCCMGHVVKHLLLGHGVNPNVYEVDEKDEDGLIKELELINGGDEKTLISNLQFSAVFIGGRLFGGLDRVMAAH ITGDLVPLLNKLELCGFDPHSFAFASSSFLFFYNCLQCLQLLVICPKKKKKKKKKNS
Physicochemical properties
Number of amino acids:		177
Molecular weight:		15,147.587
Theoretical pI:		10.419
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		19940 19940
Instability index:		54.156
aromaticity		0.136
GRAVY		-0.256
Secondary Structure Fraction
Helix		0.368
turn		0.160
sheet		0.144

Acc_NO	ORF type	length	start-end position (strand +/-)
>GT915408.1	complete	125	112-489(+)
Amino Acid sequence :
MRIKATKLQLVQKRNQITRYMSSHNSVQPTKQSTPNKHSRKLQITYQGFLITTVDQFKLFDKTIFILFINLINVRINSMTQKQMLHYMPHTTSFSHYYRNWVLCYHVIDHLHFAFSFTHR WMVVI*
Physicochemical properties
Number of amino acids:		125
Molecular weight:		15,147.587
Theoretical pI:		10.419
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		19940 19940
Instability index:		54.156
aromaticity		0.136
GRAVY		-0.256
Secondary Structure Fraction
Helix		0.368
turn		0.160
sheet		0.144