Acc_NO	ORF type	length	start-end position (strand +/-)
>GT915491.1	5prime_partial	173	2-523(+)
Amino Acid sequence :
KICKSKVNELQAPSESEVNNNIIKGIEEYRKVNGLNRHDDHENYVDRLYGSEKVETDQVPSLAVEDVRRSCNNIAGSICINESGPSENQIKLPIVNLVDIEKHMYMAVVPDPDILIRSSG ATRLSNFLLWQTAHCPLYSPTALWPELGLRHLVWAVLIYQRSHKYLEKKRKQL*
Physicochemical properties
Number of amino acids:		173
Molecular weight:		19,805.396
Theoretical pI:		7.165
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		26930 27180
Instability index:		60.595
aromaticity		0.064
GRAVY		-0.467
Secondary Structure Fraction
Helix		0.324
turn		0.249
sheet		0.243