Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GT915493.1 | complete | 152 | 100-558(+) |
Amino Acid sequence : | |||
MALKGKVETEVEIKATADEFYNFLKSTPHQLPSISGDKIQGVEHEQGDWDSHGHGSIKVWKLVLEGEVETVKEKVEFDDESKTMTCSGLEGEQIFKMYKMFKAIYQALPKDEGCFVRLAI EYEKHNKNIPDPTKYIDLMTKVVKDMGNHLKA* | |||
Physicochemical properties | |||
Number of amino acids: | 152 | ||
Molecular weight: | 17,337.635 | ||
Theoretical pI: | 5.535 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18575 | ||
Instability index: | 23.156 | ||
aromaticity | 0.086 | ||
GRAVY | -0.586 | ||
Secondary Structure Fraction | |||
Helix | 0.283 | ||
turn | 0.178 | ||
sheet | 0.263 |