Acc_NO	ORF type	length	start-end position (strand +/-)
>GT915493.1	complete	152	100-558(+)
Amino Acid sequence :
MALKGKVETEVEIKATADEFYNFLKSTPHQLPSISGDKIQGVEHEQGDWDSHGHGSIKVWKLVLEGEVETVKEKVEFDDESKTMTCSGLEGEQIFKMYKMFKAIYQALPKDEGCFVRLAI EYEKHNKNIPDPTKYIDLMTKVVKDMGNHLKA*
Physicochemical properties
Number of amino acids:		152
Molecular weight:		17,337.635
Theoretical pI:		5.535
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		18450 18575
Instability index:		23.156
aromaticity		0.086
GRAVY		-0.586
Secondary Structure Fraction
Helix		0.283
turn		0.178
sheet		0.263