Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GT915523.1 | complete | 149 | 89-538(+) |
Amino Acid sequence : | |||
MADQLTDEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGYISAAELRHVMTNLGEKLTDE EVDEMIREADVNGDGQINYEEFVKIMMAK* | |||
Physicochemical properties | |||
Number of amino acids: | 149 | ||
Molecular weight: | 16,890.567 | ||
Theoretical pI: | 4.152 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
Instability index: | 25.246 | ||
aromaticity | 0.067 | ||
GRAVY | -0.645 | ||
Secondary Structure Fraction | |||
Helix | 0.242 | ||
turn | 0.168 | ||
sheet | 0.336 |