Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GT915551.1 | 5prime_partial | 105 | 2-319(+) |
Amino Acid sequence : | |||
KKLDSEYSMAKRLIPSLNRILVEKILPPSKTNAGILLPEKTTKLNSGKVVVVGPGARDRDGKLIPVHVKEGDTVLLPEYGGMEVKLGEKEYHLFREDDILGALHE* | |||
Physicochemical properties | |||
Number of amino acids: | 105 | ||
Molecular weight: | 11,614.409 | ||
Theoretical pI: | 8.146 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
Instability index: | 29.618 | ||
aromaticity | 0.038 | ||
GRAVY | -0.340 | ||
Secondary Structure Fraction | |||
Helix | 0.324 | ||
turn | 0.238 | ||
sheet | 0.295 |