Acc_NO	ORF type	length	start-end position (strand +/-)
>GT915585.1	internal	104	1-312(+)
Amino Acid sequence :
KGPVVKFDDKWVSDSDVIVGILEDKYPIPSLKTPPEFASAGSNIFSTFVTFLKSKNPDDGSEQALLTELKALDEHPKAHGPYVAGEKISAVDLSLAPTLYHLDV
Physicochemical properties
Number of amino acids:		104
Molecular weight:		10,829.998
Theoretical pI:		8.530
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		9970 10095
Instability index:		40.100
aromaticity		0.097
GRAVY		-0.085
Secondary Structure Fraction
Helix		0.272
turn		0.369
sheet		0.194

Acc_NO	ORF type	length	start-end position (strand +/-)
>GT915585.1	internal	103	311-3(-)
Amino Acid sequence :
TSRWYSVGAKLKSTALIFSPATYGPCALGCSSNAFNSVSKACSDPSSGFLLFRKVTKVENIFDPAEANSGGVLREGIGYLSSRIPTITSESDTHLSSNFTTGP
Physicochemical properties
Number of amino acids:		103
Molecular weight:		10,829.998
Theoretical pI:		8.530
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		9970 10095
Instability index:		40.100
aromaticity		0.097
GRAVY		-0.085
Secondary Structure Fraction
Helix		0.272
turn		0.369
sheet		0.194