Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GT915599.1 | 5prime_partial | 105 | 1-318(+) |
Amino Acid sequence : | |||
TGIIFGNIVYETSSNVSERTVVVLNDIHIDIMDYISPATCADVSFRTMWAEFEWENKVAVNTVIQDEKEFLNHIIKSTNMKCLTPLSALEGECGFLAANLYAKSV* | |||
Physicochemical properties | |||
Number of amino acids: | 105 | ||
Molecular weight: | 11,736.263 | ||
Theoretical pI: | 4.576 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
Instability index: | 32.769 | ||
aromaticity | 0.095 | ||
GRAVY | 0.165 | ||
Secondary Structure Fraction | |||
Helix | 0.352 | ||
turn | 0.210 | ||
sheet | 0.257 |