Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GT915604.1 | 5prime_partial | 143 | 1-432(+) |
Amino Acid sequence : | |||
WIKDPNKKEDETSKMALQWMILTYVVVAEAVLALILTVPSPKVLKNRLVSLVSFILQSALFIVPFAGFQLLDIYWKNEHRLICSSDTCTAAERDRYEKSIYKAQRNIVLCASACLLYWCI FRICKFYKEIQKLEEVEKRCKDQ* | |||
Physicochemical properties | |||
Number of amino acids: | 143 | ||
Molecular weight: | 16,729.626 | ||
Theoretical pI: | 8.823 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30940 31315 | ||
Instability index: | 49.860 | ||
aromaticity | 0.112 | ||
GRAVY | 0.094 | ||
Secondary Structure Fraction | |||
Helix | 0.392 | ||
turn | 0.126 | ||
sheet | 0.280 |