Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GT915658.1 | 5prime_partial | 150 | 1-453(+) |
Amino Acid sequence : | |||
RYLITWGEDRRYWRWLKLKETSDELIDVAELLDVCWLEMHAKFDTKMLSPGVLYEIVFVIKIKKAGYGWHVPVKVILTLPDGTKQQNKVNLLDTPREEWMEITVGEFKTSNGQLGEIDIS MYEIEGGNWKSGLVVKGIEIRPKNGNFNHN* | |||
Physicochemical properties | |||
Number of amino acids: | 150 | ||
Molecular weight: | 17,451.942 | ||
Theoretical pI: | 5.968 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 45950 45950 | ||
Instability index: | 39.971 | ||
aromaticity | 0.107 | ||
GRAVY | -0.361 | ||
Secondary Structure Fraction | |||
Helix | 0.367 | ||
turn | 0.207 | ||
sheet | 0.240 |