Acc_NO	ORF type	length	start-end position (strand +/-)
>GU133370.1	complete	131	145-540(+)
Amino Acid sequence :
MFLLAKHVDAKACTRECGHFSYGICPRSEGSPEKPICTNCCSGYKGCNYYSAKGDLICEGESDPRNPNDCTFECDTQIAYSKCPRSEGKMIIKPTGCTTCCTGYQGCYYFDQDGDFVCEG ESPEPKTTAYY*
Physicochemical properties
Number of amino acids:		131
Molecular weight:		14,457.090
Theoretical pI:		4.974
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		14900 15900
Instability index:		53.537
aromaticity		0.115
GRAVY		-0.598
Secondary Structure Fraction
Helix		0.198
turn		0.267
sheet		0.160