Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GU133371.1 | 5prime_partial | 147 | 3-446(+) |
Amino Acid sequence : | |||
AVHKVSFLACLLVLGWMFLLAKHVDAKACTRECGHFSYGICPRSEGSPEKPICTNCCSGYKGCNYYSAKGDLICEGESDPRNPNDCTFECDTQIAYSKCPRSEGKMIIKPTGCTTCCTGY QGCYYFDQDGDFVCEGESPEPKTTAYY* | |||
Physicochemical properties | |||
Number of amino acids: | 147 | ||
Molecular weight: | 16,195.236 | ||
Theoretical pI: | 5.335 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20400 21400 | ||
Instability index: | 56.582 | ||
aromaticity | 0.116 | ||
GRAVY | -0.346 | ||
Secondary Structure Fraction | |||
Helix | 0.238 | ||
turn | 0.252 | ||
sheet | 0.184 |