Acc_NO	ORF type	length	start-end position (strand +/-)
>GU133372.1	complete	155	1-468(+)
Amino Acid sequence :
MAIYKVALLLLFGMIVLGSNADGKPCTRECDTRIAYGICPLSETKRINQICTNCCAGKKGCMYFSNDGTFICEGESEYVSEVPVDNKPCPRNCDGRIAYGICPLSENKRINQICTNCCAG KKGCLYFSNDGTFICEGESEYVSENDLQKIKVAIS*
Physicochemical properties
Number of amino acids:		155
Molecular weight:		16,977.437
Theoretical pI:		5.547
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		10430 11430
Instability index:		37.016
aromaticity		0.077
GRAVY		-0.119
Secondary Structure Fraction
Helix		0.271
turn		0.265
sheet		0.200