Acc_NO	ORF type	length	start-end position (strand +/-)
>GU133373.1	internal	174	3-524(+)
Amino Acid sequence :
CDTRIDYGICPVSETKRINQICTNCCAGKKGCMYFSDDGTFICEGESEYVSEVPVDNKPCPRNCDGRIAYGICPLSETKRINQICTNCCAGKKGCMYFSNDGTFICEGESEYVSEVPVDN KPCPRNCDGRIAYGICPLSENKRINQICTNCCAGKKGCLYFSNDGTFICEGESE
Physicochemical properties
Number of amino acids:		174
Molecular weight:		19,124.532
Theoretical pI:		4.934
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		11920 13295
Instability index:		44.425
aromaticity		0.080
GRAVY		-0.403
Secondary Structure Fraction
Helix		0.224
turn		0.287
sheet		0.138