| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >GU220360.1 | complete | 162 | 1-489(+) |
Amino Acid sequence : | |||
| MTTVTWSHEIESSADPAPLFKASMLDWHNLAPKIWPDIVVSSTAVSGGGNHSIGSVRQLNFAPGVRPFAFVKERLDFIDMEKLECKSSLVEGGLIGVKLESISFHYKFEAASNGGCIVKL TVTLKTLAGAVAEGETESTKEGVTKRIKAVEAYLLANPTAYA* | |||
Physicochemical properties | |||
| Number of amino acids: | 162 | ||
| Molecular weight: | 15,327.983 | ||
| Theoretical pI: | 4.450 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10470 | ||
| Instability index: | 47.591 | ||
| aromaticity | 0.093 | ||
| GRAVY | -0.042 | ||
Secondary Structure Fraction | |||
| Helix | 0.307 | ||
| turn | 0.250 | ||
| sheet | 0.257 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >GU220360.1 | 5prime_partial | 140 | 489-67(-) |
Amino Acid sequence : | |||
| LCISRWIGEEISLYSFDPLSHTLLGTFCFPFSNSSGECLECDSQLNNTTSVACCLELVVEGNRLELHTDKTPFHKATLALQFFHVDEIETFLDKGEGPHSGSKIELPDASDAVVAPTGYG CAADDYIGPNFRCEVVPVEH* | |||
Physicochemical properties | |||
| Number of amino acids: | 140 | ||
| Molecular weight: | 15,327.983 | ||
| Theoretical pI: | 4.450 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10470 | ||
| Instability index: | 47.591 | ||
| aromaticity | 0.093 | ||
| GRAVY | -0.042 | ||
Secondary Structure Fraction | |||
| Helix | 0.307 | ||
| turn | 0.250 | ||
| sheet | 0.257 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >GU220360.1 | complete | 162 | 1-489(+) |
Amino Acid sequence : | |||
| MTTVTWSHEIESSADPAPLFKASMLDWHNLAPKIWPDIVVSSTAVSGGGNHSIGSVRQLNFAPGVRPFAFVKERLDFIDMEKLECKSSLVEGGLIGVKLESISFHYKFEAASNGGCIVKL TVTLKTLAGAVAEGETESTKEGVTKRIKAVEAYLLANPTAYA* | |||
Physicochemical properties | |||
| Number of amino acids: | 162 | ||
| Molecular weight: | 15,327.983 | ||
| Theoretical pI: | 4.450 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10470 | ||
| Instability index: | 47.591 | ||
| aromaticity | 0.093 | ||
| GRAVY | -0.042 | ||
Secondary Structure Fraction | |||
| Helix | 0.307 | ||
| turn | 0.250 | ||
| sheet | 0.257 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >GU220360.1 | 5prime_partial | 140 | 489-67(-) |
Amino Acid sequence : | |||
| LCISRWIGEEISLYSFDPLSHTLLGTFCFPFSNSSGECLECDSQLNNTTSVACCLELVVEGNRLELHTDKTPFHKATLALQFFHVDEIETFLDKGEGPHSGSKIELPDASDAVVAPTGYG CAADDYIGPNFRCEVVPVEH* | |||
Physicochemical properties | |||
| Number of amino acids: | 140 | ||
| Molecular weight: | 15,327.983 | ||
| Theoretical pI: | 4.450 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10470 | ||
| Instability index: | 47.591 | ||
| aromaticity | 0.093 | ||
| GRAVY | -0.042 | ||
Secondary Structure Fraction | |||
| Helix | 0.307 | ||
| turn | 0.250 | ||
| sheet | 0.257 | ||