Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GU568337.1 | internal | 288 | 1-864(+) |
Amino Acid sequence : | |||
GDWYETGLHIFFGAYPNVQNLFGELGINDRLQWKEHSMIFAMPNKPGQFSRFDFPEILPAPLNGIWAILKNNEMLTWPEKVKFAIGILPAMAGGQDYVEAQDGLTVKEWMCKQGIPDRVS DEVFVAMSKALNFINPEELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLCKPIVDHVQTLGGQVQINSRLQKIELNNDGTVKHFVLSNGNIVEGDAYVSAMPVDILKQLLPEEWKELS HFKKLEKLVGVPVINIHIWFDRKLENTYDHLLFSRSSLLSVYADMSVP | |||
Physicochemical properties | |||
Number of amino acids: | 288 | ||
Molecular weight: | 32,724.435 | ||
Theoretical pI: | 5.520 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 47440 47565 | ||
Instability index: | 43.092 | ||
aromaticity | 0.101 | ||
GRAVY | -0.133 | ||
Secondary Structure Fraction | |||
Helix | 0.351 | ||
turn | 0.243 | ||
sheet | 0.267 |