Acc_NO	ORF type	length	start-end position (strand +/-)
>GU575296.1	internal	99	2-298(+)
Amino Acid sequence :
RVPGIGLVFTDLTSGIPANFSRFVTNLPAYHRILVFVCVKSVPVPFVLPAERYLVGRVGPAAHRSYRCIVRYGYRDVHQDVDSFESELVSRLADFIRYN
Physicochemical properties
Number of amino acids:		99
Molecular weight:		11,243.854
Theoretical pI:		9.441
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		8940 9065
Instability index:		29.666
aromaticity		0.131
GRAVY		0.174
Secondary Structure Fraction
Helix		0.414
turn		0.232
sheet		0.172