Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GU575297.1 | internal | 100 | 1-300(+) |
Amino Acid sequence : | |||
YLQRQCRSRRTKNRLSTRSLWCVRCLFSKSRRVRRAVVTSAVNGYNLIRSGRVDSGSYPVRNVVRSDSRIRTQLSCSRLVLCRRDRERVRWNRCLIRRGT | |||
Physicochemical properties | |||
Number of amino acids: | 100 | ||
Molecular weight: | 11,275.558 | ||
Theoretical pI: | 5.031 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
Instability index: | 55.119 | ||
aromaticity | 0.091 | ||
GRAVY | -0.499 | ||
Secondary Structure Fraction | |||
Helix | 0.283 | ||
turn | 0.253 | ||
sheet | 0.242 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GU575297.1 | internal | 99 | 3-299(+) |
Amino Acid sequence : | |||
STKTMSFEEDEESFEHTLLVVREVSVFKIPPRPTSGGYKCGEWLQSDKIWTGRLRVVSCKERCEIRLEDPNSAELFAACFVPPGQRESSVESVLDSSRY | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 11,275.558 | ||
Theoretical pI: | 5.031 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
Instability index: | 55.119 | ||
aromaticity | 0.091 | ||
GRAVY | -0.499 | ||
Secondary Structure Fraction | |||
Helix | 0.283 | ||
turn | 0.253 | ||
sheet | 0.242 |