Acc_NO	ORF type	length	start-end position (strand +/-)
>GU575298.1	internal	245	3-737(+)
Amino Acid sequence :
TVAVCFFVEVGYAKPDSSEVLHGLFVPQLKGTGATKLAISLLGAMVMPHNLFLHSALVLSRKIPRSVNGIKEACRYYLIESGLALMVAFLINISVISVTGAVCHSPSMSPDDQEKCEDLD LNKASFLLKNVLGNWSSKLFAIALLASGQSSTITGTYAGQYVMQGFLDLRLKPWIRNFLTRCLAIVPSLVVSLIGGAGGAGNLIIIASMILSFELPFALIPLLKFTSSKTKMGSHANPVA VSAAT
Physicochemical properties
Number of amino acids:		245
Molecular weight:		14,356.954
Theoretical pI:		9.760
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		2980 3230
Instability index:		42.227
aromaticity		0.068
GRAVY		0.086
Secondary Structure Fraction
Helix		0.295
turn		0.242
sheet		0.280

Acc_NO	ORF type	length	start-end position (strand +/-)
>GU575298.1	5prime_partial	132	736-338(-)
Amino Acid sequence :
VAAETATGFACEPILVLLLVNLSNGIRAKGSSKDKIIEAIMIKFPAPPAPPMSETTKLGTMAKHRVKKFLIHGFSRKSRKPCITYCPAYVPVIVELCPDASKAIANSLELQLPKTFLSKK EALFKSKSSHFS*
Physicochemical properties
Number of amino acids:		132
Molecular weight:		14,356.954
Theoretical pI:		9.760
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		2980 3230
Instability index:		42.227
aromaticity		0.068
GRAVY		0.086
Secondary Structure Fraction
Helix		0.295
turn		0.242
sheet		0.280