Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GU575299.1 | internal | 275 | 2-826(+) |
Amino Acid sequence : | |||
NIKTQVSQLIGKTPLVYLNKVSEGCGAYIAVKQEMMQPTSSIKDRPAFAMINDAEKKGLITPGKTTLIEPTSGNMGISMAFMAAMKGYKIILTMPSYTSLERRVTMRAFGADLVITDPTK GMEGTVKKAYDLLESTPNAFMLQQFSNPANTQVHFETTGPEIWEDTQGNVDIFVMGIGSGGTVSGVGQYLKSKNPNVKIYGIEPTESNVLNGGKPGPHQITGNGVGFKPDILDMDVMEEV LMVSSEESVNMARELALKEGLMVGISSGANTVAAL | |||
Physicochemical properties | |||
Number of amino acids: | 275 | ||
Molecular weight: | 12,231.878 | ||
Theoretical pI: | 10.005 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 20970 | ||
Instability index: | 18.902 | ||
aromaticity | 0.143 | ||
GRAVY | -0.048 | ||
Secondary Structure Fraction | |||
Helix | 0.381 | ||
turn | 0.286 | ||
sheet | 0.143 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GU575299.1 | complete | 105 | 655-338(-) |
Amino Acid sequence : | |||
MRTWFSTIQYIAFSWLNSIYLDIRIFGFQILSNTRDSASTSYSHDKDVNITLSVFPNFRTSGLKMNLSIGRIGELLKHKSIRCRFQKIISLLNSSFHSFSWISDN* | |||
Physicochemical properties | |||
Number of amino acids: | 105 | ||
Molecular weight: | 12,231.878 | ||
Theoretical pI: | 10.005 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 20970 | ||
Instability index: | 18.902 | ||
aromaticity | 0.143 | ||
GRAVY | -0.048 | ||
Secondary Structure Fraction | |||
Helix | 0.381 | ||
turn | 0.286 | ||
sheet | 0.143 |