Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GU575302.1 | internal | 238 | 1-714(+) |
Amino Acid sequence : | |||
LYLPKLAEQAERYEEMVPFMDKLVLNFTPAGELTVEERNLLSVAYKNVIGSLRAAWRIVSSIEQKEESRKNEEHVHLVKEYRGKVENELSQVCAGILKLLESNLVPSASTSESKVFYLKM KGDYYRYLAEFKVGDERKQAAEDTMNSYKAAQEIALIDLPPTHPIRLGLALNFSVFYFEILNSSDKACSMAKQAFEEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDAQDQLDES | |||
Physicochemical properties | |||
Number of amino acids: | 238 | ||
Molecular weight: | 27,106.456 | ||
Theoretical pI: | 4.818 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27390 27515 | ||
Instability index: | 41.098 | ||
aromaticity | 0.088 | ||
GRAVY | -0.345 | ||
Secondary Structure Fraction | |||
Helix | 0.319 | ||
turn | 0.189 | ||
sheet | 0.361 |