Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GU575303.1 | 3prime_partial | 102 | 1-306(+) |
Amino Acid sequence : | |||
MAKLAEQAERYEEMVEFMEKVAKVDVEELTVEERSFLSVAYKNVIGARRASWRIISSIEQKEESRGNEDHVSSIKEYRAKIEAELSKICDGILSLLESHLVP | |||
Physicochemical properties | |||
Number of amino acids: | 102 | ||
Molecular weight: | 11,701.183 | ||
Theoretical pI: | 5.012 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
Instability index: | 50.273 | ||
aromaticity | 0.059 | ||
GRAVY | -0.387 | ||
Secondary Structure Fraction | |||
Helix | 0.304 | ||
turn | 0.167 | ||
sheet | 0.373 |