Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GU575304.1 | internal | 125 | 1-375(+) |
Amino Acid sequence : | |||
IPTRDCYHRHTRSLYWEGKLILPFGDQFWFRFLLGWLMPPKIALLKATQSEAIRNYYHDHHVIQDLLVPLYKVGDCLEWVHREMEVYPIWLCPHRIYKLPVRPMIYPEPGFEKHKRQGDT EYAQM | |||
Physicochemical properties | |||
Number of amino acids: | 125 | ||
Molecular weight: | 15,223.592 | ||
Theoretical pI: | 8.461 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 40910 41035 | ||
Instability index: | 49.876 | ||
aromaticity | 0.152 | ||
GRAVY | -0.426 | ||
Secondary Structure Fraction | |||
Helix | 0.376 | ||
turn | 0.160 | ||
sheet | 0.240 |