Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GU575306.1 | internal | 137 | 1-411(+) |
Amino Acid sequence : | |||
PPELSLPQTGKQIKEAKTKEEIAESFKSLKPDSTFYHLFNGNFMAFSHGNEIPSHPRSIVVMDDIFCIFSGGLDNTFDLRKHYGLSRQATEAMIMVEAYKVLRDRAPYPPDQVIKELEGK FAFILFDSKASTLFLAR | |||
Physicochemical properties | |||
Number of amino acids: | 137 | ||
Molecular weight: | 15,561.667 | ||
Theoretical pI: | 6.512 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 5960 | ||
Instability index: | 39.993 | ||
aromaticity | 0.117 | ||
GRAVY | -0.294 | ||
Secondary Structure Fraction | |||
Helix | 0.307 | ||
turn | 0.226 | ||
sheet | 0.263 |