Acc_NO	ORF type	length	start-end position (strand +/-)
>GU575307.1	internal	135	3-407(+)
Amino Acid sequence :
LIRVYKNGRVERLFGSPTVPPLPEDPATGVSSKDIDISPEIKARIYLPKLTNDQKLPILVYYHGGAFCLESAFSFLDHRYLNLIVAESNVIAVSVEYRLAPENPLPVVYEDSWSALQWVG SHVESKPGFEKEAWL
Physicochemical properties
Number of amino acids:		135
Molecular weight:		15,185.167
Theoretical pI:		5.339
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		26930 26930
Instability index:		40.633
aromaticity		0.111
GRAVY		-0.097
Secondary Structure Fraction
Helix		0.378
turn		0.267
sheet		0.259