Acc_NO	ORF type	length	start-end position (strand +/-)
>GU575308.1	internal	119	1-357(+)
Amino Acid sequence :
KCMACDKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLGNYNSFEGVLYCRPHFDQLFKQTGSLDKSFEGTPKIVKPQKLIDSEKPQVAKVTSMFGGTREKCFGCKNTVYPTEKVSVNG
Physicochemical properties
Number of amino acids:		119
Molecular weight:		13,447.475
Theoretical pI:		9.223
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		7450 7950
Instability index:		20.931
aromaticity		0.101
GRAVY		-0.505
Secondary Structure Fraction
Helix		0.269
turn		0.210
sheet		0.160