Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GU575311.1 | internal | 109 | 3-329(+) |
Amino Acid sequence : | |||
KDQGFEILAFPCNQFLWQEPGTNEEIQQTVCTRFKAEFPVFEKIDVNGDNVAPLYKFLKSEKGGFLGNAVKWNFTKFLVNKEGKVVERYAPKTPPLQFEKDIQNLLGSA | |||
Physicochemical properties | |||
Number of amino acids: | 109 | ||
Molecular weight: | 12,460.088 | ||
Theoretical pI: | 6.504 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
Instability index: | 35.942 | ||
aromaticity | 0.138 | ||
GRAVY | -0.448 | ||
Secondary Structure Fraction | |||
Helix | 0.330 | ||
turn | 0.229 | ||
sheet | 0.229 |