Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GU575312.1 | internal | 161 | 2-484(+) |
Amino Acid sequence : | |||
PAIMDGRFKLSESHAILRYLACAFPRIADHWYPADLYKRAKVESVMDWHRTTFPRGPGSYAFYSVLAPAVGLPLNTKAAARTEKNFIASLATIESVWLQKKGRFLLGSNQPSIADLSLAC EIMQLEVLDEKDQERILGPFKRVQKWLDDTKNAMAPHFEEV | |||
Physicochemical properties | |||
Number of amino acids: | 161 | ||
Molecular weight: | 18,251.849 | ||
Theoretical pI: | 8.664 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29450 29575 | ||
Instability index: | 48.501 | ||
aromaticity | 0.106 | ||
GRAVY | -0.226 | ||
Secondary Structure Fraction | |||
Helix | 0.311 | ||
turn | 0.193 | ||
sheet | 0.311 |