Acc_NO	ORF type	length	start-end position (strand +/-)
>GU575316.1	internal	142	1-426(+)
Amino Acid sequence :
FAEMRVSSSGFNPQPEEATGEKKCLNSELWHACAGPLVSLPPVGSRVVYFPQGHSEQVAASTNKEVDAHIPNYPGLPPQLICQLHNLTMHADVETDEVYAQMTLQPLSPQEQKDVCLLPA ELGIPSKQPTNYFCKTLTASDT
Physicochemical properties
Number of amino acids:		142
Molecular weight:		15,504.335
Theoretical pI:		4.922
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		11460 11710
Instability index:		63.978
aromaticity		0.063
GRAVY		-0.356
Secondary Structure Fraction
Helix		0.254
turn		0.275
sheet		0.275