Acc_NO	ORF type	length	start-end position (strand +/-)
>GU575318.1	internal	228	1-684(+)
Amino Acid sequence :
FLPPFLENMPKLRALIIINYSAGNAVLHNMTVFSYLTNLRSLWFEKISVTHLSDSTDPLYNLRKISLMLCDMKNSFDESDVDLPGLFPQLSEFTMDHCINFNKLPSSICRLHKLNSLSIT NCDSLYELPSDLGELQTLQVLRIYACPHLKRLPPGIGHLVKLKYLDISQCVGLRCLPEAIGCCRNLEKIDMRECPQINSLPSALAFLESLRCVICDDEVFCQWQDVEK
Physicochemical properties
Number of amino acids:		228
Molecular weight:		25,999.117
Theoretical pI:		5.674
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		19940 20690
Instability index:		48.900
aromaticity		0.079
GRAVY		0.064
Secondary Structure Fraction
Helix		0.355
turn		0.237
sheet		0.276