Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GU575320.1 | internal | 134 | 2-403(+) |
Amino Acid sequence : | |||
IEKKQLMNSRKMDVGMSPAASEGDIKPEIMPFSVSTRPTHQIYNDFMNFDSSDSLPKLHTDSSCSEHVPSPCEREVQSEPKLNLSDWEESALDFPFNYIDATTTTSLLGSSSPFQNCYET SPLQDIFMYLQKPF | |||
Physicochemical properties | |||
Number of amino acids: | 134 | ||
Molecular weight: | 15,181.770 | ||
Theoretical pI: | 4.532 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
Instability index: | 81.632 | ||
aromaticity | 0.097 | ||
GRAVY | -0.599 | ||
Secondary Structure Fraction | |||
Helix | 0.246 | ||
turn | 0.306 | ||
sheet | 0.224 |