Acc_NO	ORF type	length	start-end position (strand +/-)
>GU575320.1	internal	134	2-403(+)
Amino Acid sequence :
IEKKQLMNSRKMDVGMSPAASEGDIKPEIMPFSVSTRPTHQIYNDFMNFDSSDSLPKLHTDSSCSEHVPSPCEREVQSEPKLNLSDWEESALDFPFNYIDATTTTSLLGSSSPFQNCYET SPLQDIFMYLQKPF
Physicochemical properties
Number of amino acids:		134
Molecular weight:		15,181.770
Theoretical pI:		4.532
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		11460 11585
Instability index:		81.632
aromaticity		0.097
GRAVY		-0.599
Secondary Structure Fraction
Helix		0.246
turn		0.306
sheet		0.224