Acc_NO	ORF type	length	start-end position (strand +/-)
>GU575322.1	internal	105	2-316(+)
Amino Acid sequence :
DFCGGSKPFMYNFTTQSISQSVSSSSMEVGVVPDHNTMTDVSNMFVRNSVVDGLPNPISSSDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKR
Physicochemical properties
Number of amino acids:		105
Molecular weight:		12,059.543
Theoretical pI:		10.422
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5960 5960
Instability index:		43.866
aromaticity		0.095
GRAVY		-0.830
Secondary Structure Fraction
Helix		0.238
turn		0.286
sheet		0.152