Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GU575322.1 | internal | 105 | 2-316(+) |
Amino Acid sequence : | |||
DFCGGSKPFMYNFTTQSISQSVSSSSMEVGVVPDHNTMTDVSNMFVRNSVVDGLPNPISSSDREARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKR | |||
Physicochemical properties | |||
Number of amino acids: | 105 | ||
Molecular weight: | 12,059.543 | ||
Theoretical pI: | 10.422 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 5960 | ||
Instability index: | 43.866 | ||
aromaticity | 0.095 | ||
GRAVY | -0.830 | ||
Secondary Structure Fraction | |||
Helix | 0.238 | ||
turn | 0.286 | ||
sheet | 0.152 |