Acc_NO	ORF type	length	start-end position (strand +/-)
>GU575325.1	internal	154	3-464(+)
Amino Acid sequence :
IQAAFREQSFKLQTKAVETLNPEIEARNIVAAMKIQHAFRNYESRKKLAAAARIQYRFRTWKMRKEFLTMRRHAIKIQAVFRGFQERKQYRKIVWSVGVLEKAVLRWRLKRKGFRGLQVQ SSEPVDIIKPDGDVEEDFFRASRKQAEERVERSV
Physicochemical properties
Number of amino acids:		154
Molecular weight:		15,651.840
Theoretical pI:		7.960
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		15470 15595
Instability index:		52.483
aromaticity		0.142
GRAVY		-0.116
Secondary Structure Fraction
Helix		0.358
turn		0.246
sheet		0.216

Acc_NO	ORF type	length	start-end position (strand +/-)
>GU575325.1	5prime_partial	134	464-60(-)
Amino Acid sequence :
DRPFNTLFSLFPTGSEEVLLHITVRLDDIHWFTRLNLKTTKAFSLQTPSQDCLFKHPNRPNYLAILLPFLETTEHGLNFDRMTPHGKKFFPHFPSSEPILDSCSSSQFFTRLIIAKSMLN LHSSNYITCFYLWI*
Physicochemical properties
Number of amino acids:		134
Molecular weight:		15,651.840
Theoretical pI:		7.960
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		15470 15595
Instability index:		52.483
aromaticity		0.142
GRAVY		-0.116
Secondary Structure Fraction
Helix		0.358
turn		0.246
sheet		0.216