Acc_NO	ORF type	length	start-end position (strand +/-)
>GU575326.1	internal	154	1-462(+)
Amino Acid sequence :
KGNHNHPKPQSTRRSSSSAASSAIQSYNTQTNEVPDHRSYGSNGTGQMDSVATPENSSISFGDDDHEHTSQKSSRSRGDDHDEEEPDSKRWKRESESEGLSALGGSRTVREPRVVVQTTS DIDILDDGYRWRKYGQKVVKGNPNPRSYYKCTST
Physicochemical properties
Number of amino acids:		154
Molecular weight:		12,269.756
Theoretical pI:		10.396
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		6990 6990
Instability index:		49.779
aromaticity		0.039
GRAVY		-0.233
Secondary Structure Fraction
Helix		0.333
turn		0.098
sheet		0.284

Acc_NO	ORF type	length	start-end position (strand +/-)
>GU575326.1	5prime_partial	102	2-310(+)
Amino Acid sequence :
RVITTIQSLSLLEDRRHPQLHLQFNLIIHKLMKCQIIDPMVQMAQDKWIQLQHLRILRFHLGMMIMSTLLKRVVGQEEMIMMKRNRTQKDGKEKAKVKVYLH*
Physicochemical properties
Number of amino acids:		102
Molecular weight:		12,269.756
Theoretical pI:		10.396
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		6990 6990
Instability index:		49.779
aromaticity		0.039
GRAVY		-0.233
Secondary Structure Fraction
Helix		0.333
turn		0.098
sheet		0.284