Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GU575326.1 | internal | 154 | 1-462(+) |
Amino Acid sequence : | |||
KGNHNHPKPQSTRRSSSSAASSAIQSYNTQTNEVPDHRSYGSNGTGQMDSVATPENSSISFGDDDHEHTSQKSSRSRGDDHDEEEPDSKRWKRESESEGLSALGGSRTVREPRVVVQTTS DIDILDDGYRWRKYGQKVVKGNPNPRSYYKCTST | |||
Physicochemical properties | |||
Number of amino acids: | 154 | ||
Molecular weight: | 12,269.756 | ||
Theoretical pI: | 10.396 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 49.779 | ||
aromaticity | 0.039 | ||
GRAVY | -0.233 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.098 | ||
sheet | 0.284 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GU575326.1 | 5prime_partial | 102 | 2-310(+) |
Amino Acid sequence : | |||
RVITTIQSLSLLEDRRHPQLHLQFNLIIHKLMKCQIIDPMVQMAQDKWIQLQHLRILRFHLGMMIMSTLLKRVVGQEEMIMMKRNRTQKDGKEKAKVKVYLH* | |||
Physicochemical properties | |||
Number of amino acids: | 102 | ||
Molecular weight: | 12,269.756 | ||
Theoretical pI: | 10.396 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 49.779 | ||
aromaticity | 0.039 | ||
GRAVY | -0.233 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.098 | ||
sheet | 0.284 |