Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GU575329.1 | internal | 187 | 1-561(+) |
Amino Acid sequence : | |||
RASRGCCFVICPSREEANKAITACHNKQTLPGASSPLQVKYADGVLERLEHKLFVGMLPKNVSDLEVSSLFSQYGTITDLQILRGSQQASRGYAFLKYEKKEQAIAAVEALNGKHTMEGA TVPLVVKWADTERERQARRTQKALSQASNASNSGQHPSLYGSLSMGYMPPYNGYAYQTPGTYGLMQY | |||
Physicochemical properties | |||
Number of amino acids: | 187 | ||
Molecular weight: | 20,574.105 | ||
Theoretical pI: | 9.143 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21890 22140 | ||
Instability index: | 45.610 | ||
aromaticity | 0.086 | ||
GRAVY | -0.457 | ||
Secondary Structure Fraction | |||
Helix | 0.257 | ||
turn | 0.257 | ||
sheet | 0.278 |