Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GU575331.1 | internal | 182 | 2-547(+) |
Amino Acid sequence : | |||
HARGASAKGFFEVTHDISHLTCADFLRAPGAQTPVICRFSTVVHERGSPESIRDIRGFAVKFYTREGNFDLVGNNVPVFFNRDAKSFPDTIRALKPNPKSHIQENWRILDFFSFLPESLH TFAFFYDDVCLPTDYRHMEGFGVHAYQLINKAGKAHYVKFHWKPTCGVKCMSEEEAIRVGGT | |||
Physicochemical properties | |||
Number of amino acids: | 182 | ||
Molecular weight: | 20,701.262 | ||
Theoretical pI: | 8.322 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18700 | ||
Instability index: | 36.620 | ||
aromaticity | 0.137 | ||
GRAVY | -0.293 | ||
Secondary Structure Fraction | |||
Helix | 0.308 | ||
turn | 0.220 | ||
sheet | 0.192 |