Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GU575334.1 | internal | 141 | 2-424(+) |
Amino Acid sequence : | |||
GLAPFRGFLQERMALKKEGAELGPAVLFFGCRNRQMDYIYQDELDNFLEAGALSELVVAFSREGPNKEYVQHKMTEKAADIWNMISQGGYVYVCGDAKGVARDVHRTLHTIAQDQGSLDN SKTESFVKNLQTTGRYLRDVW | |||
Physicochemical properties | |||
Number of amino acids: | 141 | ||
Molecular weight: | 15,939.828 | ||
Theoretical pI: | 5.930 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20065 | ||
Instability index: | 34.952 | ||
aromaticity | 0.106 | ||
GRAVY | -0.441 | ||
Secondary Structure Fraction | |||
Helix | 0.298 | ||
turn | 0.199 | ||
sheet | 0.277 |