Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GU575335.1 | internal | 104 | 1-312(+) |
Amino Acid sequence : | |||
YEKSCPKAMYTIKNTVANAVTNERRMGASLLRLHFHDCFVNGCDGSVLLDDTSDFTGEKSARPNSNSLRGFDVIDKIKSQVEKVCPGVVSCADIVAIAARDSVV | |||
Physicochemical properties | |||
Number of amino acids: | 104 | ||
Molecular weight: | 11,268.702 | ||
Theoretical pI: | 6.894 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
Instability index: | 21.114 | ||
aromaticity | 0.058 | ||
GRAVY | -0.121 | ||
Secondary Structure Fraction | |||
Helix | 0.279 | ||
turn | 0.240 | ||
sheet | 0.202 |